- OLFML2A Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84655
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PRO34319
- Human
- OLFML2A
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: PTSIPATTTT ATTTPTPTTS LLPTEPPSGP EVSSQGREAS CEGTLRAVDP PVRHHSYGRH EGAWMKDPAA RDDRIYVTNY YY
- 0.1 ml (also 25ul)
- olfactomedin like 2A
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMKDPAARDDRIYVTNYYY
Specifications/Features
Available conjugates: Unconjugated